red90.co.uk
Navigation
  • Home
  • Team
  • Contact
  • Home
  • Team
  • Contact

Tag Archive

Below you'll find a list of all posts that have been tagged as “good working relationship”

It’s nice to be appreciated

I had a really nice surprise today. Something happened that hasn’t happened in many years of being in business. One of our oldest customers came to us late this week with a bunch of photos and some funky ideas & asked me to turn it into an intro sequence for a conference with all the heads of the various departments …

Read More
clientsdeadlinesgood working relationshiphappyreferralsrewardtestimonial